PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6DL_41CBE9959.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 125aa    MW: 14434.7 Da    PI: 10.4324
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6DL_41CBE9959.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.7e-171461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+eEd++lvd ++  G g+W++ ++   ++R++k+c++rw +yl
  Traes_6DL_41CBE9959.1 14 KGPWTPEEDKQLVDFIQANGHGSWRLLPKLAELNRCGKSCRLRWTNYL 61
                           79********************************************97 PP

2Myb_DNA-binding51.13.2e-1667112148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg++T+eE++ +v+++   G++ W+ Ia+ ++ gRt++++k++w+++l
  Traes_6DL_41CBE9959.1  67 RGPFTAEEQKSIVQLHGIVGNK-WSMIAAQLP-GRTDNEIKNYWNTHL 112
                            89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.101961IPR017930Myb domain
SuperFamilySSF466893.59E-3111108IPR009057Homeodomain-like
SMARTSM007173.7E-131363IPR001005SANT/Myb domain
PfamPF002491.0E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-231568IPR009057Homeodomain-like
CDDcd001671.58E-91661No hitNo description
PROSITE profilePS5129425.45762116IPR017930Myb domain
SMARTSM007173.1E-1466114IPR001005SANT/Myb domain
PfamPF002494.1E-1467112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-2769116IPR009057Homeodomain-like
CDDcd001675.47E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MGRAPCCDRK GLKKGPWTPE EDKQLVDFIQ ANGHGSWRLL PKLAELNRCG KSCRLRWTNY  60
LRPDIKRGPF TAEEQKSIVQ LHGIVGNKWS MIAAQLPGRT DNEIKNYWNT HLKKQLRRMG  120
LDEPP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-30121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1086211e-165AK108621.1 Oryza sativa Japonica Group cDNA clone:002-147-D04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006647594.11e-85PREDICTED: myb-related protein Myb4-like
SwissprotQ8GWP06e-61MYB39_ARATH; Transcription factor MYB39
TrEMBLM8CVE21e-91M8CVE2_AEGTA; Transcription factor MYB39
STRINGMLOC_39554.21e-85(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.14e-71myb domain protein 17